Cagrilintide is a long-acting analogue of amylin, a naturally occurring peptide that is released in conjunction with insulin. Cagrilintide has shown promise in animal trials as a treatment for obesity and type 2 diabetes. It has been studied for benefits not just in type 2 diabetes, but for liver damage, alcohol-related liver disease, and heart/blood vessel disease. There is some speculation about the role of this peptide in Alzheimer’s disease as well, but no research has been published in that particular sub-domain, yet. Many trials, however, have looked at the combination of cagrilintide and semaglutide in the treatment of obesity and type 2 diabetes. The two proteins appear to work synergistically to provide more robust and more permanent weight loss effects. It is important to note that while preclinical studies suggest promising therapeutic potential, clinical trials in humans are limited. Further research needs to be done to determine the efficacy and safety profiles.
Sequence:XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C¡H:N¡O S₂ CH O₂
Molecular Weight: 4409.01 g/mol
PubChem SlD:171397054
CAS Number:1415456-99-3
Synonyms:AT42613,AM833[1]




